AmelieSchreiber
commited on
Commit
•
575416b
1
Parent(s):
60da2ec
Update README.md
Browse files
README.md
CHANGED
@@ -1,9 +1,118 @@
|
|
1 |
---
|
2 |
library_name: peft
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3 |
---
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4 |
## Training procedure
|
5 |
|
6 |
-
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7 |
|
8 |
|
|
|
|
|
9 |
- PEFT 0.4.0
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
---
|
2 |
library_name: peft
|
3 |
+
license: mit
|
4 |
+
language:
|
5 |
+
- en
|
6 |
+
tags:
|
7 |
+
- transformers
|
8 |
+
- biology
|
9 |
+
- esm
|
10 |
+
- esm2
|
11 |
+
- protein
|
12 |
+
- protein language model
|
13 |
---
|
14 |
+
# ESM-2 RNA Binding Site LoRA
|
15 |
+
|
16 |
+
This is a Parameter Efficient Fine Tuning (PEFT) Low Rank Adaptation (LoRA) of
|
17 |
+
the [esm2_t12_35M_UR50D](https://huggingface.co/facebook/esm2_t12_35M_UR50D) model for the (binary) token classification task of
|
18 |
+
predicting RNA binding sites of proteins. You can also find a version of this model
|
19 |
+
that was fine-tuned without LoRA [here](https://huggingface.co/AmelieSchreiber/esm2_t6_8M_UR50D_rna_binding_site_predictor).
|
20 |
+
|
21 |
## Training procedure
|
22 |
|
23 |
+
This is a Low Rank Adaptation (LoRA) of `esm2_t12_35M_UR50D`,
|
24 |
+
trained on `166` protein sequences in the [RNA binding sites dataset](https://huggingface.co/datasets/AmelieSchreiber/data_of_protein-rna_binding_sites)
|
25 |
+
using a `85/15` train/test split. This model was trained with class weighting due to the imbalanced nature
|
26 |
+
of the RNA binding site dataset (fewer binding sites than non-binding sites). This model has slightly improved
|
27 |
+
precision, recall, and F1 score over [AmelieSchreiber/esm2_t12_35M_weighted_lora_rna_binding](https://huggingface.co/AmelieSchreiber/esm2_t12_35M_weighted_lora_rna_binding)
|
28 |
+
but may suffer from mild overfitting, as indicated by the training loss being slightly lower than the eval loss. If you are searching for
|
29 |
+
binding sites and aren't worried about false positives, the higher recall may make this model preferable to the other RNA binding site predictors.
|
30 |
+
|
31 |
+
You can train your own version
|
32 |
+
using [this notebook](https://huggingface.co/AmelieSchreiber/esm2_t6_8M_weighted_lora_rna_binding/blob/main/LoRA_binding_sites_no_sweeps_v2.ipynb)!
|
33 |
+
You just need the RNA `binding_sites.xml` file [found here](https://huggingface.co/datasets/AmelieSchreiber/data_of_protein-rna_binding_sites).
|
34 |
+
You may also need to run some `pip install` statements at the beginning of the script. If you are running in colab run:
|
35 |
+
|
36 |
+
```python
|
37 |
+
!pip install transformers[torch] datasets peft -q
|
38 |
+
```
|
39 |
+
```python
|
40 |
+
!pip install accelerate -U -q
|
41 |
+
```
|
42 |
+
Try to improve upon these metrics by adjusting the hyperparameters:
|
43 |
+
```
|
44 |
+
{'eval_loss': 0.500779926776886,
|
45 |
+
'eval_precision': 0.1708695652173913,
|
46 |
+
'eval_recall': 0.8397435897435898,
|
47 |
+
'eval_f1': 0.2839595375722543,
|
48 |
+
'eval_auc': 0.771835775620126,
|
49 |
+
'epoch': 11.0}
|
50 |
+
{'loss': 0.4171,
|
51 |
+
'learning_rate': 0.00032491416877500004,
|
52 |
+
'epoch': 11.43}
|
53 |
+
```
|
54 |
+
|
55 |
+
A similar model can also be trained using the Github with a training script and conda env YAML, which can be
|
56 |
+
[found here](https://github.com/Amelie-Schreiber/esm2_LoRA_binding_sites/tree/main). This version uses wandb sweeps for hyperparameter search.
|
57 |
+
However, it does not use class weighting.
|
58 |
|
59 |
|
60 |
+
### Framework versions
|
61 |
+
|
62 |
- PEFT 0.4.0
|
63 |
+
|
64 |
+
## Using the Model
|
65 |
+
|
66 |
+
To use the model, try running the following pip install statements:
|
67 |
+
```python
|
68 |
+
!pip install transformers peft -q
|
69 |
+
```
|
70 |
+
then try tunning:
|
71 |
+
```python
|
72 |
+
from transformers import AutoModelForTokenClassification, AutoTokenizer
|
73 |
+
from peft import PeftModel
|
74 |
+
import torch
|
75 |
+
|
76 |
+
# Path to the saved LoRA model
|
77 |
+
model_path = "AmelieSchreiber/esm2_t12_35M_UR50D_RNA_LoRA_weighted"
|
78 |
+
# ESM2 base model
|
79 |
+
base_model_path = "facebook/esm2_t12_35M_UR50D"
|
80 |
+
|
81 |
+
# Load the model
|
82 |
+
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path)
|
83 |
+
loaded_model = PeftModel.from_pretrained(base_model, model_path)
|
84 |
+
|
85 |
+
# Ensure the model is in evaluation mode
|
86 |
+
loaded_model.eval()
|
87 |
+
|
88 |
+
# Load the tokenizer
|
89 |
+
loaded_tokenizer = AutoTokenizer.from_pretrained(base_model_path)
|
90 |
+
|
91 |
+
# Protein sequence for inference
|
92 |
+
protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence
|
93 |
+
|
94 |
+
# Tokenize the sequence
|
95 |
+
inputs = loaded_tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length')
|
96 |
+
|
97 |
+
# Run the model
|
98 |
+
with torch.no_grad():
|
99 |
+
logits = loaded_model(**inputs).logits
|
100 |
+
|
101 |
+
# Get predictions
|
102 |
+
tokens = loaded_tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens
|
103 |
+
predictions = torch.argmax(logits, dim=2)
|
104 |
+
|
105 |
+
# Define labels
|
106 |
+
id2label = {
|
107 |
+
0: "No binding site",
|
108 |
+
1: "Binding site"
|
109 |
+
}
|
110 |
+
|
111 |
+
# Print the predicted labels for each token
|
112 |
+
for token, prediction in zip(tokens, predictions[0].numpy()):
|
113 |
+
if token not in ['<pad>', '<cls>', '<eos>']:
|
114 |
+
print((token, id2label[prediction]))
|
115 |
+
|
116 |
+
```
|
117 |
+
|
118 |
+
|